PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00333.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 438aa    MW: 46036.9 Da    PI: 9.6445
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00333.1_g00016.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.73.8e-16353401553
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                              +r+rr++kNRe+A rsR+RK+a++ eLe k  +L++eN +Lk  l el+
  Rsa1.0_00333.1_g00016.1 353 RRQRRMIKNRESAARSRARKQAYTVELEAKLNQLKEENAQLKHALGELE 401
                              79*****************************************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-16349413IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.714351403IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.3E-14353405No hitNo description
CDDcd147073.69E-24353407No hitNo description
SuperFamilySSF579593.44E-11353401No hitNo description
PfamPF001705.4E-14353401IPR004827Basic-leucine zipper domain
PROSITE patternPS000360356371IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010152Biological Processpollen maturation
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MVSRETEMIS EREVESSTRH NGGAGGGGGE NHPFSSLGRQ SSIYSLTLDE FQHALCENGK  60
NFGSMNMDEF LVSIWNAEEN NNNNNHQATA AAASHPVPPS HNGFNNNNGG GESGVFAGGG  120
GGSSGSQAAN KRPGIVKQPS LPRQGSLTLP SPLCRKTVEE VWSEIHRGGG NGGGESNGRG  180
TNTNGQNNAD NGGGGGESAA RQPTFGEMTL EDFLVKAGVV REHPTNPKPI LNPTPSSVIP  240
ASTQQQQLYG VFPGGGDPTF AVGVGDYGKR AGGGGGGYQQ APPVQTGVCY GGGGGFGAGG  300
QQMGMVGPLS PVSSDGIGHG QVDNIGGQYG VDMGGLRGRK RVVDGPVEKV VERRQRRMIK  360
NRESAARSRA RKQAYTVELE AKLNQLKEEN AQLKHALGEL ERKRKQQYFE SLKTRAQPKV  420
PKVSGRLRTL MRNPSCPL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4140290.0KC414029.1 Brassica napus ABA insensitive PP2C protein 5 (ABI5.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001303059.10.0protein ABSCISIC ACID-INSENSITIVE 5
RefseqXP_013632062.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5
SwissprotQ9SJN00.0ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A0D3BRL40.0A0A0D3BRL4_BRAOL; Uncharacterized protein
TrEMBLX2C3J60.0X2C3J6_BRANA; ABA insensitive PP2C protein 5
STRINGBra005287.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM92012536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-171bZIP family protein